PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02343.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 199aa    MW: 22205.9 Da    PI: 9.3214
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02343.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-393292262
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             ++++lkcprCds ntkfCyynny+lsqPr++Ck+CrryWtkGG+lrn+PvGgg+rkn k+s
  Rsa1.0_02343.1_g00007.1 32 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHYCKNCRRYWTKGGSLRNIPVGGGSRKNTKRS 92
                             57899****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.6E-323490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0313690IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-253791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MQDLTSAAAY YHHQSMLMMA AKQQQQPELL PEQEQLKCPR CDSPNTKFCY YNNYNLSQPR  60
HYCKNCRRYW TKGGSLRNIP VGGGSRKNTK RSSSSSSSSS SSASSNNLND KTVAVVPDQK  120
PSSEEESRPK LMEEERKMTG REMDPTRMLY GVPVGDQRFS PLMGSDVGMG GISYETGSKW  180
YPGIHLGLGP GIRRNDGHA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009144887.11e-101PREDICTED: dof zinc finger protein DOF1.7-like
SwissprotO821552e-84DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLM4ENQ31e-101M4ENQ3_BRARP; Uncharacterized protein
STRINGBra030423.1-P1e-100(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.15e-73DOF zinc finger protein 1